aloksahababu
aloksahababu
10-10-2022
Mathematics
contestada
Fill in: -5^2=____-5^2
Respuesta :
VER TODAS LAS RESPUESTAS ( 59+ )
Otras preguntas
so I am at this home supply store and I found this really cool vase that is 24.99 but it has an 80% sale so if I add sales tax how much would I pay(7 percent sa
Ma smith invested $1240 more in stock A than in stock B if she invested a total of $6000 in the two stock How much did she invest in stock A?
2. What are expressive elements? dynamics, articulation, tempo, form intense volume transcribed notes musical symbols
why was Cornwallis position a problem for his troops
If 125 students take a test in psychology and 20 get scores of less than or equal to 50%, then what is the percentile rank of a test score of 50%? Group of answ
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein
Find the constant of proportionality for this proportional relationship and write an equation. Use b for bags of candy and p for pieces of candy. answer and get
Recognizing the Health Benefits of Technology Complete these statements that demonstrate how technology can promote a healthy lifestyle. An individual decides t
Why might you need to use the addition or subtraction property of equality more than once after you have used the distributive property and combined like terms?
A car travelling at 30 km/h takes 40 minutes to complete a journey. How long would it take if it travelled at 60 km/h?
