sydthekid1690 sydthekid1690
  • 11-03-2024
  • Business
contestada

Consumption caused by a change in income is
a. consumption.
b. autonomous induced

Respuesta :

Otras preguntas

3. A plumber charges $25 for a service call plus $50 per hour of service. How many hours did he work in order for his total bill to be $600? 
What’s the awnser to this question.
Negative ten is no less than two times a number plus fourteen.
In the polar molecule HBr, what charge does the H bear
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein
8x+11-x=7x Please solve for x!
Rocks around mid-ocean ridges teach scientists about A. how wide abyssal plains are B. how earthquakes happen C. changes in the earth's crust
Incorrecto or correcto: yo espero que ellos lleguen pronto
Helpp me with question 18.
what is the example of sedimentary rock ?​