201850106 201850106

10-10-2020
Mathematics

contestada

Find
f '(a).
f(x) = 3 − 4x

Respuesta :

wegnerkolmp2741o wegnerkolmp2741o

10-10-2020

Answer:

f'(a) = -4

Step-by-step explanation:

f(x) = 3 − 4x

Take the derivative of the function

f'(x) = -4

f'(a) = -4

Answer Link

Otras preguntas

PLS HELP!!! In section VIII, the Code of Justinian makes a connection between being subject to a master and being subject to a parent. Compare and contrast slav

Article 3 of the Constitution allows the Supreme Court to do what with federal law? A. Create it B. Veto it C. Interpret it D. Re-write it

Do the following side lengths form a right triangle? 7,24,25

which is the verb in this sentence spongebob squarepants eats a cookie every afternoon

"Earhart is commemorated in numerous books about her life, especially as a role model for young girls, and has earned her place as one of the most intriguing fi

I need help with this I am giving 60 points

Help fast Pleaseeee Please show all workkkkk

1. Define Product Launch?

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

there are 2 speed cameras,one in area where the speed limit is 30km/h,and another in area where the speed limit is 50km/h,IN WHICH ONE WILL THERE BE A SMALLER T